PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn170471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 364aa    MW: 39511.9 Da    PI: 8.2158
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn170471genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32199254156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Achn170471 199 KARRCWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 254
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.219196256IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-29196257IPR009057Homeodomain-like
SuperFamilySSF466893.33E-18197257IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-27199254IPR006447Myb domain, plants
PfamPF002491.4E-7201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MQRCQEYIEA LEKERCKIQI FYGFCCVVGF AAIESCRQQL SWSPTTTEYF HGQSECSGQT  60
SSEVPVLEEF IPIKRSSCSD DDEEQSEKPK NNNKDCKSND KSLKKSDWLT SFQLWNETPD  120
LPTKEDSPRN LSVIELKKNG GGAFHPFKKE KSGGTTKTDP PVSVLAIAAS SSTEIGGGDC  180
GGGSGGGKKE EKEGQSQRKA RRCWSPELHR RFLHALQQLG GSHAATPKQI RELMKVDGLT  240
NDEVKSHLQK YRLHTRRPTP PSIHNNNNPQ QPQFVVVGGI WVPPPEYTVV AASGEASGVA  300
TTNGIYAPIA APPPPPTQRQ QYNQSNQSHS GERGSHRGGG GGGRCNSPAT SSSTHTSTAS  360
LAF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3836302e-63FQ383630.1 Vitis vinifera clone SS0ABG1YE07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-146PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-146D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.17e-71G2-like family protein